PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g047247m
Common NameCISIN_1g047247mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 386aa    MW: 43343.1 Da    PI: 5.1966
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g047247mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS269.98.5e-83763723304
               GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL ecA+a+s++d +++++lL+ l+elasp+gd  q+la+yf++AL  + ++s++++yk+l++ ++++++ +++ +    f+evsP+ +f+
  orange1.1g047247m  76 KLLKECARAISDKDSSKIHHLLWMLNELASPYGDCDQKLASYFLQALFCKATESGQRCYKTLTSVAEKSHSFDSARKLILKFQEVSPWTTFG 167
                        7999**********************************************************9999985554444444445*********** PP

               GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl.vakr 185
                        h++ N aIlea++ge+++HiiD++ + ++QWp+Ll+aLa+R++++p+l++T+v+   s  +  ++e+g+r++kfA+ +gvpfef+v+   +r
  orange1.1g047247m 168 HVASNGAILEALDGETKLHIIDMSNTLCTQWPTLLEALATRNDETPHLKLTVVVT-VSLVRLVMKEIGQRMEKFARLMGVPFEFKVItGLNR 258
                        *******************************************************.55699*************************94456* PP

               GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse..sFlerflealeyysalfdsleakl 275
                        l +l+  +L vk++Ea+aVn++ +l r+      +e+ r +v+++++sl+Pkvv++ve+ead++s+  +F++ f e+l++y+  f++le+++
  orange1.1g047247m 259 LVELTKGTLGVKEDEAVAVNCIGALRRVA-----VEE-RGAVIQMFQSLKPKVVTIVEEEADLTSSryDFVKCFEECLRFYTLYFEMLEESF 344
                        ****************************8.....444.89**********************9665459*********************** PP

               GRAS 276 preseerikvErellgreivnvvacegae 304
                         ++s+er ++Ere  +r+iv v+ac  ++
  orange1.1g047247m 345 VPTSNERLMLERE-CSRDIVRVLACDDDN 372
                        *************.89*********9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.70148386IPR005202Transcription factor GRAS
PfamPF035142.9E-8076372IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MDITLFSPKG THSHHFFSLS NQQLQQSNGD QIALDMQTNN NNNIQPQNSC HTSTSRSSDS  60
GEPCADTTGG NKWASKLLKE CARAISDKDS SKIHHLLWML NELASPYGDC DQKLASYFLQ  120
ALFCKATESG QRCYKTLTSV AEKSHSFDSA RKLILKFQEV SPWTTFGHVA SNGAILEALD  180
GETKLHIIDM SNTLCTQWPT LLEALATRND ETPHLKLTVV VTVSLVRLVM KEIGQRMEKF  240
ARLMGVPFEF KVITGLNRLV ELTKGTLGVK EDEAVAVNCI GALRRVAVEE RGAVIQMFQS  300
LKPKVVTIVE EEADLTSSRY DFVKCFEECL RFYTLYFEML EESFVPTSNE RLMLERECSR  360
DIVRVLACDD DNNSSNNGNG DREEEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-26783568285GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442965.10.0hypothetical protein CICLE_v10020072mg
RefseqXP_006478752.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF71e-123SHR_ARATH; Protein SHORT-ROOT
TrEMBLA0A067E2K30.0A0A067E2K3_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0017s05450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16273814
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-118GRAS family protein